PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.16G023600.1.p
Common NameGLYMA_16G023600, LOC100795763
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARF
Protein Properties Length: 717aa    MW: 79453.6 Da    PI: 6.4629
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.16G023600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.32.9e-23134234198
                          EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                          f+k+lt sd++++g +++ +k+a+e+       +   + +++l  +d++g +W++k+iyr++++r++lt+GW+ Fv +++L +gD +vF 
  Glyma.16G023600.1.p 134 FCKILTASDTSTHGGFSVLRKHATEClpaldmtQ--ATPTQELAAKDLHGFEWKFKHIYRGQPRRHLLTTGWSTFVASKRLVAGDAFVFL 221
                          99****************************9543..445569************************************************ PP

                          E-SSSEE..EEEEE- CS
                   B3  84 ldgrsefelvvkvfr 98 
                            + + ++l+v+v+r
  Glyma.16G023600.1.p 222 --RGEHGQLRVGVRR 234
                          ..4489999****98 PP

2Auxin_resp101.21.3e-33260339183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          a+ha+ t+++F v+Y+Pr+  s+F+v ++k+++a+++k+s+GmRfkm+fe++ds+err+sGt+vgv d++   W+nS+WrsLk
  Glyma.16G023600.1.p 260 ASHAVMTRTMFLVYYKPRT--SQFIVGLNKYLEAVNNKFSLGMRFKMRFEGDDSPERRFSGTIVGVGDVSA-GWSNSQWRSLK 339
                          689***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.83E-41122263IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.7E-40126249IPR015300DNA-binding pseudobarrel domain
CDDcd100177.31E-19132234No hitNo description
SMARTSM010194.2E-20134236IPR003340B3 DNA binding domain
PfamPF023623.6E-21134234IPR003340B3 DNA binding domain
PROSITE profilePS5086311.561134236IPR003340B3 DNA binding domain
PfamPF065071.1E-31260339IPR010525Auxin response factor
PfamPF023094.7E-5588632IPR033389AUX/IAA domain
SuperFamilySSF542772.94E-12592672No hitNo description
PROSITE profilePS5174527.357596677IPR000270PB1 domain
PfamPF023094.5E-6637678IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 717 aa     Download sequence    Send to blast
MAHLGCCNLG GPGSSGTSLP EKGLKDDDLY RELWKLCAGP LVDVPRTGDR VFYFPQGHME  60
QLQASTDQEL NQEIPHFNLP AKIFCRVVNI QLLAEQDTDE VYACIALLPE SDQTEPTNPD  120
PNISEPPKQK FHSFCKILTA SDTSTHGGFS VLRKHATECL PALDMTQATP TQELAAKDLH  180
GFEWKFKHIY RGQPRRHLLT TGWSTFVASK RLVAGDAFVF LRGEHGQLRV GVRRLARQQS  240
PMPSSVISSQ SMHLGVLATA SHAVMTRTMF LVYYKPRTSQ FIVGLNKYLE AVNNKFSLGM  300
RFKMRFEGDD SPERRFSGTI VGVGDVSAGW SNSQWRSLKV QWDEPATIPR PDRVSCWEIE  360
PFVASTALNV TQPAVKGKRS RPADVSSSAA SGFWYHGSSN ELSQLGAATA EVQSKENQVV  420
PCSLRQKDII NSNPIDANNS SISSRVRMEG VWPSSPHLNV TPNLFSDPNN NSVLARSPIS  480
GYLNVPSRSS DGPTCEHVED GKKIENSLDC WLFGVNLTNN CSNVIITTPS ERELRGPISS  540
SVAPSGPKES IPAAACETER VQTPNYSLSN KGQKQIISEA SPNEWQNKQA TVPSMRTRTK  600
VQMQGVAVGR AFDLTTLSGY DDLIEELEKL FEIRGELHSQ DKWAVTFTDD ENDMMLVGDD  660
PWPEFCNMVK RIFICSREDL KKMKCCKLPA SSSEVEEVLL SPDSQNRDET QQSHMP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1702336213355Auxin response factor 1
4ldw_A1e-1702336213355Auxin response factor 1
4ldv_A1e-1702336213355Auxin response factor 1
4ldx_B1e-1702336213355Auxin response factor 1
4ldx_A1e-1702336213355Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.277380.0leaf
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006598900.10.0PREDICTED: auxin response factor 18 isoform X1
SwissprotQ6YVY00.0ARFG_ORYSJ; Auxin response factor 7
TrEMBLA0A0B2Q7A60.0A0A0B2Q7A6_GLYSO; Auxin response factor
TrEMBLK7MET60.0K7MET6_SOYBN; Auxin response factor
STRINGGLYMA16G02650.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15113396
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9